Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 104152..104753 | Replicon | plasmid pAVS0051-A |
Accession | NZ_CP124430 | ||
Organism | Escherichia coli strain AVS0051 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | QJP74_RS24880 | Protein ID | WP_001216034.1 |
Coordinates | 104373..104753 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QJP74_RS24875 | Protein ID | WP_001190712.1 |
Coordinates | 104152..104373 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP74_RS24850 (99460) | 99460..100455 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QJP74_RS24855 (100459) | 100459..101391 | + | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
QJP74_RS24865 (102276) | 102276..102416 | - | 141 | WP_283192233.1 | hypothetical protein | - |
QJP74_RS24870 (102413) | 102413..103969 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
QJP74_RS24875 (104152) | 104152..104373 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QJP74_RS24880 (104373) | 104373..104753 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QJP74_RS24885 (104758) | 104758..104937 | + | 180 | WP_001513661.1 | hypothetical protein | - |
QJP74_RS24890 (104965) | 104965..105243 | + | 279 | Protein_123 | pdcB | - |
QJP74_RS24895 (105248) | 105248..105661 | + | 414 | Protein_124 | integrase core domain-containing protein | - |
QJP74_RS24900 (105611) | 105611..105946 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
QJP74_RS24905 (106156) | 106156..107136 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
QJP74_RS24910 (107380) | 107380..108783 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
QJP74_RS24915 (108770) | 108770..109702 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-27 | senB | 1..113044 | 113044 | |
- | inside | IScluster/Tn | - | - | 101528..110533 | 9005 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T280245 WP_001216034.1 NZ_CP124430:104373-104753 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |