Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 104152..104753 Replicon plasmid pAVS0051-A
Accession NZ_CP124430
Organism Escherichia coli strain AVS0051

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP74_RS24880 Protein ID WP_001216034.1
Coordinates 104373..104753 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP74_RS24875 Protein ID WP_001190712.1
Coordinates 104152..104373 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP74_RS24850 (99460) 99460..100455 + 996 WP_000246636.1 hypothetical protein -
QJP74_RS24855 (100459) 100459..101391 + 933 WP_000991832.1 S-4TM family putative pore-forming effector -
QJP74_RS24865 (102276) 102276..102416 - 141 WP_283192233.1 hypothetical protein -
QJP74_RS24870 (102413) 102413..103969 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJP74_RS24875 (104152) 104152..104373 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP74_RS24880 (104373) 104373..104753 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP74_RS24885 (104758) 104758..104937 + 180 WP_001513661.1 hypothetical protein -
QJP74_RS24890 (104965) 104965..105243 + 279 Protein_123 pdcB -
QJP74_RS24895 (105248) 105248..105661 + 414 Protein_124 integrase core domain-containing protein -
QJP74_RS24900 (105611) 105611..105946 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP74_RS24905 (106156) 106156..107136 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP74_RS24910 (107380) 107380..108783 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP74_RS24915 (108770) 108770..109702 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-27 senB 1..113044 113044
- inside IScluster/Tn - - 101528..110533 9005


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280245 WP_001216034.1 NZ_CP124430:104373-104753 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280245 WP_001190712.1 NZ_CP124430:104152-104373 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References