Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3911172..3912006 Replicon chromosome
Accession NZ_CP124429
Organism Escherichia coli strain AVS0051

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP74_RS19090 Protein ID WP_000854690.1
Coordinates 3911629..3912006 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP74_RS19085 Protein ID WP_001305076.1
Coordinates 3911172..3911540 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP74_RS19045 (3906254) 3906254..3907381 + 1128 Protein_3726 hypothetical protein -
QJP74_RS19050 (3907457) 3907457..3907912 + 456 WP_000581502.1 IrmA family protein -
QJP74_RS19055 (3907991) 3907991..3908224 + 234 WP_000902034.1 DUF905 family protein -
QJP74_RS19060 (3908325) 3908325..3909143 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP74_RS19065 (3909198) 3909198..3909683 + 486 WP_000849565.1 antirestriction protein -
QJP74_RS19070 (3909699) 3909699..3910175 + 477 WP_001186726.1 RadC family protein -
QJP74_RS19075 (3910238) 3910238..3910459 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP74_RS19080 (3910478) 3910478..3911122 + 645 WP_000094916.1 hypothetical protein -
QJP74_RS19085 (3911172) 3911172..3911540 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP74_RS19090 (3911629) 3911629..3912006 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP74_RS19095 (3912003) 3912003..3912491 + 489 WP_000761699.1 DUF5983 family protein -
QJP74_RS19100 (3912508) 3912508..3912705 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP74_RS19105 (3912790) 3912790..3913635 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP74_RS19110 (3913704) 3913704..3914099 + 396 WP_000208384.1 DUF6088 family protein -
QJP74_RS19115 (3914092) 3914092..3915025 + 934 Protein_3740 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP74_RS19120 (3915442) 3915442..3915612 + 171 Protein_3741 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 3866894..3933215 66321
- flank IS/Tn - - 3915457..3915612 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280232 WP_000854690.1 NZ_CP124429:3911629-3912006 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280232 WP_001305076.1 NZ_CP124429:3911172-3911540 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References