Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2831458..2832289 Replicon chromosome
Accession NZ_CP124429
Organism Escherichia coli strain AVS0051

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP74_RS14110 Protein ID WP_000854815.1
Coordinates 2831915..2832289 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP74_RS14105 Protein ID WP_001280918.1
Coordinates 2831458..2831826 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP74_RS14060 (2826547) 2826547..2827293 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP74_RS14065 (2827376) 2827376..2827726 + 351 Protein_2752 hypothetical protein -
QJP74_RS14070 (2827742) 2827742..2828152 + 411 WP_000846703.1 hypothetical protein -
QJP74_RS14075 (2828373) 2828373..2829191 + 819 WP_242815830.1 DUF932 domain-containing protein -
QJP74_RS14080 (2829191) 2829191..2829436 + 246 WP_001164966.1 hypothetical protein -
QJP74_RS14085 (2829530) 2829530..2830003 + 474 WP_001542276.1 antirestriction protein -
QJP74_RS14090 (2830019) 2830019..2830495 + 477 WP_001186200.1 RadC family protein -
QJP74_RS14095 (2830558) 2830558..2830779 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP74_RS14100 (2830798) 2830798..2831442 + 645 WP_000086752.1 hypothetical protein -
QJP74_RS14105 (2831458) 2831458..2831826 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP74_RS14110 (2831915) 2831915..2832289 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP74_RS14115 (2832286) 2832286..2832480 + 195 WP_000988600.1 DUF5983 family protein -
QJP74_RS14120 (2832526) 2832526..2832606 + 81 Protein_2763 hypothetical protein -
QJP74_RS14125 (2832895) 2832895..2832975 - 81 WP_023441679.1 hypothetical protein -
QJP74_RS14130 (2832954) 2832954..2833277 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP74_RS14135 (2833378) 2833378..2833707 - 330 WP_000450409.1 DUF496 family protein -
QJP74_RS14140 (2833879) 2833879..2834937 - 1059 WP_001200889.1 FUSC family protein -
QJP74_RS14145 (2835135) 2835135..2835608 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP74_RS14150 (2835727) 2835727..2836893 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280229 WP_000854815.1 NZ_CP124429:2831915-2832289 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280229 WP_001280918.1 NZ_CP124429:2831458-2831826 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References