Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 531549..532384 | Replicon | chromosome |
Accession | NZ_CP124429 | ||
Organism | Escherichia coli strain AVS0051 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | QJP74_RS02505 | Protein ID | WP_000854759.1 |
Coordinates | 532007..532384 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | QJP74_RS02500 | Protein ID | WP_001295723.1 |
Coordinates | 531549..531917 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP74_RS02475 (528664) | 528664..528859 | + | 196 | Protein_476 | DUF905 family protein | - |
QJP74_RS02480 (528977) | 528977..529795 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
QJP74_RS02485 (530137) | 530137..530610 | + | 474 | WP_001350782.1 | antirestriction protein | - |
QJP74_RS02490 (530626) | 530626..531102 | + | 477 | WP_001186775.1 | RadC family protein | - |
QJP74_RS02495 (531165) | 531165..531386 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
QJP74_RS02500 (531549) | 531549..531917 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP74_RS02505 (532007) | 532007..532384 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
QJP74_RS02510 (532381) | 532381..532869 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
QJP74_RS02515 (532886) | 532886..533062 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
QJP74_RS02520 (533168) | 533168..533317 | + | 150 | Protein_485 | hypothetical protein | - |
QJP74_RS02525 (533684) | 533684..533989 | + | 306 | Protein_486 | helix-turn-helix domain-containing protein | - |
QJP74_RS02530 (534651) | 534651..536273 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimE | 517854..554956 | 37102 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280214 WP_000854759.1 NZ_CP124429:532007-532384 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |