Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 95702..96303 Replicon plasmid pAVS0247-A
Accession NZ_CP124425
Organism Escherichia coli strain AVS0247

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJB03_RS24910 Protein ID WP_001216034.1
Coordinates 95923..96303 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJB03_RS24905 Protein ID WP_001190712.1
Coordinates 95702..95923 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB03_RS24880 (91023) 91023..92018 + 996 WP_000246636.1 hypothetical protein -
QJB03_RS24885 (92061) 92061..92954 + 894 WP_001553853.1 S-4TM family putative pore-forming effector -
QJB03_RS24895 (93838) 93838..93966 - 129 Protein_120 restriction endonuclease subunit S -
QJB03_RS24900 (93963) 93963..95519 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJB03_RS24905 (95702) 95702..95923 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJB03_RS24910 (95923) 95923..96303 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJB03_RS24915 (96308) 96308..96487 + 180 WP_001513661.1 hypothetical protein -
QJB03_RS24920 (96515) 96515..96793 + 279 Protein_125 pdcB -
QJB03_RS24925 (96798) 96798..97211 + 414 Protein_126 integrase core domain-containing protein -
QJB03_RS24930 (97161) 97161..97496 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJB03_RS24935 (97706) 97706..98686 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJB03_RS24940 (98930) 98930..100333 + 1404 WP_001373486.1 S-methylmethionine permease -
QJB03_RS24945 (100320) 100320..101252 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 senB 1..104594 104594
- inside IScluster/Tn - - 93091..102209 9118


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280211 WP_001216034.1 NZ_CP124425:95923-96303 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280211 WP_001190712.1 NZ_CP124425:95702-95923 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References