Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 89790..90315 | Replicon | plasmid pAVS0247-A |
| Accession | NZ_CP124425 | ||
| Organism | Escherichia coli strain AVS0247 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QJB03_RS24870 | Protein ID | WP_001159868.1 |
| Coordinates | 89790..90095 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QJB03_RS24875 | Protein ID | WP_000813634.1 |
| Coordinates | 90097..90315 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB03_RS24855 (85700) | 85700..86866 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QJB03_RS24860 (87454) | 87454..88209 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJB03_RS24865 (88983) | 88983..89789 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| QJB03_RS24870 (89790) | 89790..90095 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJB03_RS24875 (90097) | 90097..90315 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJB03_RS24880 (91023) | 91023..92018 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| QJB03_RS24885 (92061) | 92061..92954 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
| QJB03_RS24895 (93838) | 93838..93966 | - | 129 | Protein_120 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..104594 | 104594 | |
| - | inside | IScluster/Tn | - | - | 93091..102209 | 9118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280210 WP_001159868.1 NZ_CP124425:c90095-89790 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|