Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4055574..4056192 | Replicon | chromosome |
Accession | NZ_CP124424 | ||
Organism | Escherichia coli strain AVS0247 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJB03_RS19565 | Protein ID | WP_001291435.1 |
Coordinates | 4055574..4055792 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJB03_RS19570 | Protein ID | WP_000344800.1 |
Coordinates | 4055818..4056192 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB03_RS19530 (4050861) | 4050861..4051433 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QJB03_RS19535 (4051464) | 4051464..4051775 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QJB03_RS19545 (4052154) | 4052154..4052507 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
QJB03_RS19550 (4052549) | 4052549..4054099 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJB03_RS19555 (4054263) | 4054263..4054733 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QJB03_RS19560 (4054849) | 4054849..4055400 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJB03_RS19565 (4055574) | 4055574..4055792 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJB03_RS19570 (4055818) | 4055818..4056192 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJB03_RS19575 (4056738) | 4056738..4059887 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJB03_RS19580 (4059910) | 4059910..4061103 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280197 WP_001291435.1 NZ_CP124424:c4055792-4055574 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280197 WP_000344800.1 NZ_CP124424:c4056192-4055818 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |