Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3623660..3624180 Replicon chromosome
Accession NZ_CP124424
Organism Escherichia coli strain AVS0247

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJB03_RS17480 Protein ID WP_001160964.1
Coordinates 3623896..3624180 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJB03_RS17475 Protein ID WP_000125566.1
Coordinates 3623660..3623893 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB03_RS17450 (3618733) 3618733..3619020 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJB03_RS17455 (3619079) 3619079..3620410 + 1332 WP_001183209.1 MFS transporter -
QJB03_RS17460 (3620518) 3620518..3621048 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJB03_RS17465 (3621041) 3621041..3622903 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJB03_RS17470 (3623095) 3623095..3623574 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJB03_RS17475 (3623660) 3623660..3623893 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJB03_RS17480 (3623896) 3623896..3624180 + 285 WP_001160964.1 CcdB family protein Toxin
QJB03_RS17485 (3624207) 3624207..3625055 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJB03_RS17490 (3625062) 3625062..3625439 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJB03_RS17495 (3625442) 3625442..3626263 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJB03_RS17500 (3626260) 3626260..3627249 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJB03_RS17505 (3627249) 3627249..3628535 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280195 WP_001160964.1 NZ_CP124424:3623896-3624180 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280195 WP_000125566.1 NZ_CP124424:3623660-3623893 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References