Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3384887..3385722 | Replicon | chromosome |
| Accession | NZ_CP124424 | ||
| Organism | Escherichia coli strain AVS0247 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJB03_RS16295 | Protein ID | WP_000854759.1 |
| Coordinates | 3385345..3385722 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJB03_RS16290 | Protein ID | WP_001295723.1 |
| Coordinates | 3384887..3385255 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB03_RS16260 (3380123) | 3380123..3381664 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJB03_RS16265 (3381679) | 3381679..3382425 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJB03_RS16270 (3382513) | 3382513..3383133 | + | 621 | Protein_3174 | DUF932 domain-containing protein | - |
| QJB03_RS16275 (3383475) | 3383475..3383948 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJB03_RS16280 (3383964) | 3383964..3384440 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJB03_RS16285 (3384503) | 3384503..3384724 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJB03_RS16290 (3384887) | 3384887..3385255 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB03_RS16295 (3385345) | 3385345..3385722 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJB03_RS16300 (3385719) | 3385719..3386207 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJB03_RS16305 (3386224) | 3386224..3386400 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJB03_RS16310 (3386506) | 3386506..3386655 | + | 150 | Protein_3182 | hypothetical protein | - |
| QJB03_RS16315 (3387022) | 3387022..3387327 | + | 306 | Protein_3183 | helix-turn-helix domain-containing protein | - |
| QJB03_RS16320 (3387989) | 3387989..3389611 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280193 WP_000854759.1 NZ_CP124424:3385345-3385722 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280193 WP_001295723.1 NZ_CP124424:3384887-3385255 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |