Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1829915..1830749 | Replicon | chromosome |
| Accession | NZ_CP124424 | ||
| Organism | Escherichia coli strain AVS0247 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QJB03_RS08850 | Protein ID | WP_000854690.1 |
| Coordinates | 1830372..1830749 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | QJB03_RS08845 | Protein ID | WP_001305076.1 |
| Coordinates | 1829915..1830283 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB03_RS08805 (1824997) | 1824997..1826124 | + | 1128 | Protein_1726 | hypothetical protein | - |
| QJB03_RS08810 (1826200) | 1826200..1826655 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QJB03_RS08815 (1826734) | 1826734..1826967 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| QJB03_RS08820 (1827068) | 1827068..1827886 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJB03_RS08825 (1827941) | 1827941..1828426 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| QJB03_RS08830 (1828442) | 1828442..1828918 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QJB03_RS08835 (1828981) | 1828981..1829202 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QJB03_RS08840 (1829221) | 1829221..1829865 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QJB03_RS08845 (1829915) | 1829915..1830283 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB03_RS08850 (1830372) | 1830372..1830749 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QJB03_RS08855 (1830746) | 1830746..1831234 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| QJB03_RS08860 (1831251) | 1831251..1831448 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QJB03_RS08865 (1831533) | 1831533..1832378 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QJB03_RS08870 (1832447) | 1832447..1832842 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QJB03_RS08875 (1832835) | 1832835..1833768 | + | 934 | Protein_1740 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJB03_RS08880 (1834185) | 1834185..1834355 | + | 171 | Protein_1741 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1834200..1834355 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T280186 WP_000854690.1 NZ_CP124424:1830372-1830749 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT280186 WP_001305076.1 NZ_CP124424:1829915-1830283 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|