Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 118314..118915 Replicon plasmid pAVS0155-A
Accession NZ_CP124421
Organism Escherichia coli strain AVS0155

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP63_RS25140 Protein ID WP_001216034.1
Coordinates 118535..118915 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP63_RS25135 Protein ID WP_001190712.1
Coordinates 118314..118535 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP63_RS25125 (115307) 115307..116578 - 1272 WP_023142242.1 restriction endonuclease subunit S -
QJP63_RS25130 (116575) 116575..118131 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJP63_RS25135 (118314) 118314..118535 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP63_RS25140 (118535) 118535..118915 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP63_RS25145 (118920) 118920..119099 + 180 WP_001513661.1 hypothetical protein -
QJP63_RS25150 (119127) 119127..119405 + 279 Protein_137 pdcB -
QJP63_RS25155 (119410) 119410..119823 + 414 Protein_138 integrase core domain-containing protein -
QJP63_RS25160 (119773) 119773..120108 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP63_RS25165 (120318) 120318..121298 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP63_RS25170 (121542) 121542..122945 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP63_RS25175 (122932) 122932..123864 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 senB 1..127206 127206


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280177 WP_001216034.1 NZ_CP124421:118535-118915 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280177 WP_001190712.1 NZ_CP124421:118314-118535 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References