Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 107857..108382 | Replicon | plasmid pAVS0155-A |
| Accession | NZ_CP124421 | ||
| Organism | Escherichia coli strain AVS0155 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QJP63_RS25095 | Protein ID | WP_001159868.1 |
| Coordinates | 107857..108162 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QJP63_RS25100 | Protein ID | WP_000813634.1 |
| Coordinates | 108164..108382 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP63_RS25080 (103767) | 103767..104933 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QJP63_RS25085 (105521) | 105521..106276 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP63_RS25090 (107050) | 107050..107856 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| QJP63_RS25095 (107857) | 107857..108162 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJP63_RS25100 (108164) | 108164..108382 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJP63_RS25105 (109090) | 109090..110085 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| QJP63_RS25110 (110128) | 110128..111021 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..127206 | 127206 | |
| - | flank | IS/Tn | - | - | 111158..111661 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280176 WP_001159868.1 NZ_CP124421:c108162-107857 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|