Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4563158..4563776 | Replicon | chromosome |
| Accession | NZ_CP124420 | ||
| Organism | Escherichia coli strain AVS0155 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP63_RS22270 | Protein ID | WP_001291435.1 |
| Coordinates | 4563158..4563376 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP63_RS22275 | Protein ID | WP_000344800.1 |
| Coordinates | 4563402..4563776 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP63_RS22235 (4558445) | 4558445..4559017 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| QJP63_RS22240 (4559048) | 4559048..4559359 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP63_RS22250 (4559738) | 4559738..4560091 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
| QJP63_RS22255 (4560133) | 4560133..4561683 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP63_RS22260 (4561847) | 4561847..4562317 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP63_RS22265 (4562433) | 4562433..4562984 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP63_RS22270 (4563158) | 4563158..4563376 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP63_RS22275 (4563402) | 4563402..4563776 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP63_RS22280 (4564322) | 4564322..4567471 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP63_RS22285 (4567494) | 4567494..4568687 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280170 WP_001291435.1 NZ_CP124420:c4563376-4563158 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280170 WP_000344800.1 NZ_CP124420:c4563776-4563402 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |