Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4111859..4112379 Replicon chromosome
Accession NZ_CP124420
Organism Escherichia coli strain AVS0155

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP63_RS20115 Protein ID WP_001160964.1
Coordinates 4112095..4112379 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP63_RS20110 Protein ID WP_000125566.1
Coordinates 4111859..4112092 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP63_RS20085 (4106932) 4106932..4107219 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJP63_RS20090 (4107278) 4107278..4108609 + 1332 WP_001183209.1 MFS transporter -
QJP63_RS20095 (4108717) 4108717..4109247 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP63_RS20100 (4109240) 4109240..4111102 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP63_RS20105 (4111294) 4111294..4111773 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP63_RS20110 (4111859) 4111859..4112092 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP63_RS20115 (4112095) 4112095..4112379 + 285 WP_001160964.1 CcdB family protein Toxin
QJP63_RS20120 (4112406) 4112406..4113254 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP63_RS20125 (4113261) 4113261..4113638 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP63_RS20130 (4113641) 4113641..4114462 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP63_RS20135 (4114459) 4114459..4115448 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP63_RS20140 (4115448) 4115448..4116734 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280168 WP_001160964.1 NZ_CP124420:4112095-4112379 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280168 WP_000125566.1 NZ_CP124420:4111859-4112092 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References