Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 3820146..3820741 | Replicon | chromosome |
| Accession | NZ_CP124420 | ||
| Organism | Escherichia coli strain AVS0155 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | QJP63_RS18670 | Protein ID | WP_000239579.1 |
| Coordinates | 3820391..3820741 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | QJP63_RS18665 | Protein ID | WP_001223208.1 |
| Coordinates | 3820146..3820397 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP63_RS18655 (3815811) | 3815811..3819590 | + | 3780 | WP_000060945.1 | autotransporter assembly complex protein TamB | - |
| QJP63_RS18660 (3819593) | 3819593..3819934 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| QJP63_RS18665 (3820146) | 3820146..3820397 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| QJP63_RS18670 (3820391) | 3820391..3820741 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| QJP63_RS18675 (3820821) | 3820821..3821351 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| QJP63_RS18680 (3821661) | 3821661..3822617 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| QJP63_RS18685 (3822757) | 3822757..3824259 | + | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
| QJP63_RS18690 (3824273) | 3824273..3825295 | + | 1023 | WP_001296689.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T280165 WP_000239579.1 NZ_CP124420:3820391-3820741 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |