Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 32261..33059 | Replicon | plasmid pAVS0223-B |
| Accession | NZ_CP124417 | ||
| Organism | Escherichia coli strain AVS0223 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | E2QDF3 |
| Locus tag | QJP60_RS25155 | Protein ID | WP_000072677.1 |
| Coordinates | 32538..33059 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
| Locus tag | QJP60_RS25150 | Protein ID | WP_001351987.1 |
| Coordinates | 32261..32530 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP60_RS25125 (QJP60_25125) | 27688..29028 | - | 1341 | WP_077136336.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| QJP60_RS25130 (QJP60_25130) | 29072..29812 | - | 741 | WP_001717320.1 | hypothetical protein | - |
| QJP60_RS25135 (QJP60_25135) | 30095..30862 | + | 768 | WP_283187938.1 | hypothetical protein | - |
| QJP60_RS25140 (QJP60_25140) | 30915..31268 | - | 354 | WP_160378290.1 | hypothetical protein | - |
| QJP60_RS25145 (QJP60_25145) | 31274..31942 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
| QJP60_RS25150 (QJP60_25150) | 32261..32530 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
| QJP60_RS25155 (QJP60_25155) | 32538..33059 | + | 522 | WP_000072677.1 | GNAT family N-acetyltransferase | Toxin |
| QJP60_RS25160 (QJP60_25160) | 33228..33479 | - | 252 | WP_000901559.1 | hypothetical protein | - |
| QJP60_RS25165 (QJP60_25165) | 33481..34173 | - | 693 | WP_000856757.1 | hypothetical protein | - |
| QJP60_RS25170 (QJP60_25170) | 34187..34510 | - | 324 | WP_001717323.1 | hypothetical protein | - |
| QJP60_RS25175 (QJP60_25175) | 34713..37379 | - | 2667 | WP_238064378.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..108564 | 108564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19392.17 Da Isoelectric Point: 8.6369
>T280146 WP_000072677.1 NZ_CP124417:32538-33059 [Escherichia coli]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLANHLKRQHEGKILRAYVLCTQEERPKVLGYYTLSGSCFEKESLPSRSKQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLGFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9R6P3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9R6Q7 |