Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 125410..126011 Replicon plasmid pAVS0223-A
Accession NZ_CP124416
Organism Escherichia coli strain AVS0223

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP60_RS24900 Protein ID WP_001216034.1
Coordinates 125631..126011 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP60_RS24895 Protein ID WP_001190712.1
Coordinates 125410..125631 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP60_RS24885 (122391) 122391..123674 - 1284 WP_001617890.1 restriction endonuclease subunit S -
QJP60_RS24890 (123671) 123671..125227 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJP60_RS24895 (125410) 125410..125631 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP60_RS24900 (125631) 125631..126011 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP60_RS24905 (126016) 126016..126195 + 180 WP_001513661.1 hypothetical protein -
QJP60_RS24910 (126223) 126223..126501 + 279 Protein_151 pdcB -
QJP60_RS24915 (126506) 126506..126919 + 414 Protein_152 integrase core domain-containing protein -
QJP60_RS24920 (126937) 126937..127311 - 375 WP_283187931.1 type I restriction endonuclease -
QJP60_RS24925 (127410) 127410..128391 - 982 Protein_154 IS5-like element IS5 family transposase -
QJP60_RS24930 (128635) 128635..130038 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP60_RS24935 (130025) 130025..130957 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 senB 1..134299 134299


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280145 WP_001216034.1 NZ_CP124416:125631-126011 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280145 WP_001190712.1 NZ_CP124416:125410-125631 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References