Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 125410..126011 | Replicon | plasmid pAVS0223-A |
| Accession | NZ_CP124416 | ||
| Organism | Escherichia coli strain AVS0223 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | QJP60_RS24900 | Protein ID | WP_001216034.1 |
| Coordinates | 125631..126011 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QJP60_RS24895 | Protein ID | WP_001190712.1 |
| Coordinates | 125410..125631 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP60_RS24885 (122391) | 122391..123674 | - | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
| QJP60_RS24890 (123671) | 123671..125227 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| QJP60_RS24895 (125410) | 125410..125631 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QJP60_RS24900 (125631) | 125631..126011 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QJP60_RS24905 (126016) | 126016..126195 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| QJP60_RS24910 (126223) | 126223..126501 | + | 279 | Protein_151 | pdcB | - |
| QJP60_RS24915 (126506) | 126506..126919 | + | 414 | Protein_152 | integrase core domain-containing protein | - |
| QJP60_RS24920 (126937) | 126937..127311 | - | 375 | WP_283187931.1 | type I restriction endonuclease | - |
| QJP60_RS24925 (127410) | 127410..128391 | - | 982 | Protein_154 | IS5-like element IS5 family transposase | - |
| QJP60_RS24930 (128635) | 128635..130038 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| QJP60_RS24935 (130025) | 130025..130957 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..134299 | 134299 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T280145 WP_001216034.1 NZ_CP124416:125631-126011 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |