Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3427453..3428288 | Replicon | chromosome |
| Accession | NZ_CP124415 | ||
| Organism | Escherichia coli strain AVS0223 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP60_RS16480 | Protein ID | WP_000854759.1 |
| Coordinates | 3427911..3428288 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP60_RS16475 | Protein ID | WP_001295723.1 |
| Coordinates | 3427453..3427821 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP60_RS16445 (3423454) | 3423454..3423927 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP60_RS16450 (3423943) | 3423943..3424164 | + | 222 | Protein_3213 | hypothetical protein | - |
| QJP60_RS16455 (3424359) | 3424359..3425900 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP60_RS16460 (3425915) | 3425915..3426661 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP60_RS16465 (3426749) | 3426749..3427006 | + | 258 | Protein_3216 | JAB domain-containing protein | - |
| QJP60_RS16470 (3427069) | 3427069..3427290 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP60_RS16475 (3427453) | 3427453..3427821 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP60_RS16480 (3427911) | 3427911..3428288 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP60_RS16485 (3428285) | 3428285..3428773 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP60_RS16490 (3428790) | 3428790..3428966 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP60_RS16495 (3429072) | 3429072..3429221 | + | 150 | Protein_3222 | hypothetical protein | - |
| QJP60_RS16500 (3429588) | 3429588..3429893 | + | 306 | Protein_3223 | helix-turn-helix domain-containing protein | - |
| QJP60_RS16505 (3430555) | 3430555..3432177 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280127 WP_000854759.1 NZ_CP124415:3427911-3428288 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280127 WP_001295723.1 NZ_CP124415:3427453-3427821 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |