Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1860361..1861195 Replicon chromosome
Accession NZ_CP124415
Organism Escherichia coli strain AVS0223

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP60_RS08985 Protein ID WP_000854690.1
Coordinates 1860818..1861195 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP60_RS08980 Protein ID WP_001305076.1
Coordinates 1860361..1860729 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP60_RS08940 (1855443) 1855443..1856570 + 1128 Protein_1756 hypothetical protein -
QJP60_RS08945 (1856646) 1856646..1857101 + 456 WP_000581502.1 IrmA family protein -
QJP60_RS08950 (1857180) 1857180..1857413 + 234 WP_000902034.1 DUF905 family protein -
QJP60_RS08955 (1857514) 1857514..1858332 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP60_RS08960 (1858387) 1858387..1858872 + 486 WP_000849565.1 antirestriction protein -
QJP60_RS08965 (1858888) 1858888..1859364 + 477 WP_001186726.1 RadC family protein -
QJP60_RS08970 (1859427) 1859427..1859648 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP60_RS08975 (1859667) 1859667..1860311 + 645 WP_000094916.1 hypothetical protein -
QJP60_RS08980 (1860361) 1860361..1860729 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP60_RS08985 (1860818) 1860818..1861195 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP60_RS08990 (1861192) 1861192..1861680 + 489 WP_000761699.1 DUF5983 family protein -
QJP60_RS08995 (1861697) 1861697..1861894 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP60_RS09000 (1861979) 1861979..1862824 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP60_RS09005 (1862893) 1862893..1863288 + 396 WP_000208384.1 DUF6088 family protein -
QJP60_RS09010 (1863281) 1863281..1864214 + 934 Protein_1770 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP60_RS09015 (1864631) 1864631..1864801 + 171 Protein_1771 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 1816083..1882404 66321
- flank IS/Tn - - 1864646..1864801 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280120 WP_000854690.1 NZ_CP124415:1860818-1861195 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280120 WP_001305076.1 NZ_CP124415:1860361-1860729 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References