Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 780028..780859 Replicon chromosome
Accession NZ_CP124415
Organism Escherichia coli strain AVS0223

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP60_RS04010 Protein ID WP_000854815.1
Coordinates 780485..780859 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP60_RS04005 Protein ID WP_001280918.1
Coordinates 780028..780396 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP60_RS03960 (775117) 775117..775863 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP60_RS03965 (775946) 775946..776296 + 351 Protein_781 hypothetical protein -
QJP60_RS03970 (776312) 776312..776722 + 411 WP_000846703.1 hypothetical protein -
QJP60_RS03975 (776943) 776943..777761 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP60_RS03980 (777761) 777761..778006 + 246 WP_001164966.1 hypothetical protein -
QJP60_RS03985 (778100) 778100..778573 + 474 WP_001542276.1 antirestriction protein -
QJP60_RS03990 (778589) 778589..779065 + 477 WP_001186200.1 RadC family protein -
QJP60_RS03995 (779128) 779128..779349 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP60_RS04000 (779368) 779368..780012 + 645 WP_000086752.1 hypothetical protein -
QJP60_RS04005 (780028) 780028..780396 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP60_RS04010 (780485) 780485..780859 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP60_RS04015 (780856) 780856..781050 + 195 WP_000988600.1 DUF5983 family protein -
QJP60_RS04020 (781096) 781096..781176 + 81 Protein_792 hypothetical protein -
QJP60_RS04025 (781465) 781465..781545 - 81 WP_023441679.1 hypothetical protein -
QJP60_RS04030 (781524) 781524..781847 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP60_RS04035 (781948) 781948..782277 - 330 WP_000450409.1 DUF496 family protein -
QJP60_RS04040 (782449) 782449..783507 - 1059 WP_001200889.1 FUSC family protein -
QJP60_RS04045 (783705) 783705..784178 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP60_RS04050 (784297) 784297..785463 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280117 WP_000854815.1 NZ_CP124415:780485-780859 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280117 WP_001280918.1 NZ_CP124415:780028-780396 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References