Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 126434..127035 Replicon plasmid pAVS0543-A
Accession NZ_CP124411
Organism Escherichia coli strain AVS0543

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP61_RS25060 Protein ID WP_001216034.1
Coordinates 126655..127035 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP61_RS25055 Protein ID WP_001190712.1
Coordinates 126434..126655 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP61_RS25045 (123427) 123427..124698 - 1272 WP_283201983.1 restriction endonuclease subunit S -
QJP61_RS25050 (124695) 124695..126251 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJP61_RS25055 (126434) 126434..126655 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP61_RS25060 (126655) 126655..127035 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP61_RS25065 (127040) 127040..127219 + 180 WP_001513661.1 hypothetical protein -
QJP61_RS25070 (127247) 127247..127525 + 279 Protein_153 pdcB -
QJP61_RS25075 (127530) 127530..127943 + 414 Protein_154 integrase core domain-containing protein -
QJP61_RS25080 (127893) 127893..128228 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP61_RS25085 (128438) 128438..129418 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP61_RS25090 (129662) 129662..131065 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP61_RS25095 (131052) 131052..131984 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 senB 1..135326 135326


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280111 WP_001216034.1 NZ_CP124411:126655-127035 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280111 WP_001190712.1 NZ_CP124411:126434-126655 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References