Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 126434..127035 | Replicon | plasmid pAVS0543-A |
Accession | NZ_CP124411 | ||
Organism | Escherichia coli strain AVS0543 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | QJP61_RS25060 | Protein ID | WP_001216034.1 |
Coordinates | 126655..127035 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QJP61_RS25055 | Protein ID | WP_001190712.1 |
Coordinates | 126434..126655 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP61_RS25045 (123427) | 123427..124698 | - | 1272 | WP_283201983.1 | restriction endonuclease subunit S | - |
QJP61_RS25050 (124695) | 124695..126251 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
QJP61_RS25055 (126434) | 126434..126655 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QJP61_RS25060 (126655) | 126655..127035 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QJP61_RS25065 (127040) | 127040..127219 | + | 180 | WP_001513661.1 | hypothetical protein | - |
QJP61_RS25070 (127247) | 127247..127525 | + | 279 | Protein_153 | pdcB | - |
QJP61_RS25075 (127530) | 127530..127943 | + | 414 | Protein_154 | integrase core domain-containing protein | - |
QJP61_RS25080 (127893) | 127893..128228 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
QJP61_RS25085 (128438) | 128438..129418 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
QJP61_RS25090 (129662) | 129662..131065 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
QJP61_RS25095 (131052) | 131052..131984 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..135326 | 135326 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T280111 WP_001216034.1 NZ_CP124411:126655-127035 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |