Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4074770..4075388 | Replicon | chromosome |
Accession | NZ_CP124410 | ||
Organism | Escherichia coli strain AVS0543 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJP61_RS19600 | Protein ID | WP_001291435.1 |
Coordinates | 4074770..4074988 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJP61_RS19605 | Protein ID | WP_000344800.1 |
Coordinates | 4075014..4075388 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP61_RS19565 (4070057) | 4070057..4070629 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QJP61_RS19570 (4070660) | 4070660..4070971 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QJP61_RS19580 (4071350) | 4071350..4071703 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
QJP61_RS19585 (4071745) | 4071745..4073295 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJP61_RS19590 (4073459) | 4073459..4073929 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QJP61_RS19595 (4074045) | 4074045..4074596 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJP61_RS19600 (4074770) | 4074770..4074988 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJP61_RS19605 (4075014) | 4075014..4075388 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJP61_RS19610 (4075934) | 4075934..4079083 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJP61_RS19615 (4079106) | 4079106..4080299 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280097 WP_001291435.1 NZ_CP124410:c4074988-4074770 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280097 WP_000344800.1 NZ_CP124410:c4075388-4075014 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |