Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3622426..3622946 Replicon chromosome
Accession NZ_CP124410
Organism Escherichia coli strain AVS0543

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP61_RS17440 Protein ID WP_001160964.1
Coordinates 3622662..3622946 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP61_RS17435 Protein ID WP_000125566.1
Coordinates 3622426..3622659 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP61_RS17410 (3617499) 3617499..3617786 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJP61_RS17415 (3617845) 3617845..3619176 + 1332 WP_001183209.1 MFS transporter -
QJP61_RS17420 (3619284) 3619284..3619814 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP61_RS17425 (3619807) 3619807..3621669 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP61_RS17430 (3621861) 3621861..3622340 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP61_RS17435 (3622426) 3622426..3622659 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP61_RS17440 (3622662) 3622662..3622946 + 285 WP_001160964.1 CcdB family protein Toxin
QJP61_RS17445 (3622973) 3622973..3623821 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP61_RS17450 (3623828) 3623828..3624205 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP61_RS17455 (3624208) 3624208..3625029 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP61_RS17460 (3625026) 3625026..3626015 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP61_RS17465 (3626015) 3626015..3627301 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T280095 WP_001160964.1 NZ_CP124410:3622662-3622946 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT280095 WP_000125566.1 NZ_CP124410:3622426-3622659 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References