Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3430302..3431137 | Replicon | chromosome |
Accession | NZ_CP124410 | ||
Organism | Escherichia coli strain AVS0543 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | QJP61_RS16520 | Protein ID | WP_000854759.1 |
Coordinates | 3430760..3431137 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | QJP61_RS16515 | Protein ID | WP_001295723.1 |
Coordinates | 3430302..3430670 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP61_RS16490 (3427417) | 3427417..3427612 | + | 196 | Protein_3223 | DUF905 family protein | - |
QJP61_RS16495 (3427730) | 3427730..3428548 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
QJP61_RS16500 (3428890) | 3428890..3429363 | + | 474 | WP_001350782.1 | antirestriction protein | - |
QJP61_RS16505 (3429379) | 3429379..3429855 | + | 477 | WP_001186775.1 | RadC family protein | - |
QJP61_RS16510 (3429918) | 3429918..3430139 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
QJP61_RS16515 (3430302) | 3430302..3430670 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP61_RS16520 (3430760) | 3430760..3431137 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
QJP61_RS16525 (3431134) | 3431134..3431622 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
QJP61_RS16530 (3431639) | 3431639..3431815 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
QJP61_RS16535 (3431921) | 3431921..3432070 | + | 150 | Protein_3232 | hypothetical protein | - |
QJP61_RS16540 (3432437) | 3432437..3432742 | + | 306 | Protein_3233 | helix-turn-helix domain-containing protein | - |
QJP61_RS16545 (3433404) | 3433404..3435026 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280093 WP_000854759.1 NZ_CP124410:3430760-3431137 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280093 WP_001295723.1 NZ_CP124410:3430302-3430670 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |