Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1864249..1865083 Replicon chromosome
Accession NZ_CP124410
Organism Escherichia coli strain AVS0543

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP61_RS09025 Protein ID WP_000854690.1
Coordinates 1864706..1865083 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP61_RS09020 Protein ID WP_001305076.1
Coordinates 1864249..1864617 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP61_RS08980 (1859331) 1859331..1860458 + 1128 Protein_1765 hypothetical protein -
QJP61_RS08985 (1860534) 1860534..1860989 + 456 WP_000581502.1 IrmA family protein -
QJP61_RS08990 (1861068) 1861068..1861301 + 234 WP_000902034.1 DUF905 family protein -
QJP61_RS08995 (1861402) 1861402..1862220 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP61_RS09000 (1862275) 1862275..1862760 + 486 WP_000849565.1 antirestriction protein -
QJP61_RS09005 (1862776) 1862776..1863252 + 477 WP_001186726.1 RadC family protein -
QJP61_RS09010 (1863315) 1863315..1863536 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP61_RS09015 (1863555) 1863555..1864199 + 645 WP_000094916.1 hypothetical protein -
QJP61_RS09020 (1864249) 1864249..1864617 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP61_RS09025 (1864706) 1864706..1865083 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP61_RS09030 (1865080) 1865080..1865568 + 489 WP_000761699.1 DUF5983 family protein -
QJP61_RS09035 (1865585) 1865585..1865782 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP61_RS09040 (1865867) 1865867..1866712 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP61_RS09045 (1866781) 1866781..1867176 + 396 WP_000208384.1 DUF6088 family protein -
QJP61_RS09050 (1867169) 1867169..1868102 + 934 Protein_1779 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP61_RS09055 (1868519) 1868519..1868689 + 171 Protein_1780 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 1819971..1886208 66237
- flank IS/Tn - - 1868534..1868689 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280086 WP_000854690.1 NZ_CP124410:1864706-1865083 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280086 WP_001305076.1 NZ_CP124410:1864249-1864617 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References