Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 783070..783901 | Replicon | chromosome |
| Accession | NZ_CP124410 | ||
| Organism | Escherichia coli strain AVS0543 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | QJP61_RS04035 | Protein ID | WP_000854815.1 |
| Coordinates | 783527..783901 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | QJP61_RS04030 | Protein ID | WP_001280918.1 |
| Coordinates | 783070..783438 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP61_RS03985 (778159) | 778159..778905 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP61_RS03990 (778988) | 778988..779338 | + | 351 | Protein_786 | hypothetical protein | - |
| QJP61_RS03995 (779354) | 779354..779764 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| QJP61_RS04000 (779985) | 779985..780803 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| QJP61_RS04005 (780803) | 780803..781048 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| QJP61_RS04010 (781142) | 781142..781615 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| QJP61_RS04015 (781631) | 781631..782107 | + | 477 | WP_059333688.1 | RadC family protein | - |
| QJP61_RS04020 (782170) | 782170..782391 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP61_RS04025 (782410) | 782410..783054 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| QJP61_RS04030 (783070) | 783070..783438 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP61_RS04035 (783527) | 783527..783901 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP61_RS04040 (783898) | 783898..784092 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QJP61_RS04045 (784138) | 784138..784218 | + | 81 | Protein_797 | hypothetical protein | - |
| QJP61_RS04050 (784507) | 784507..784587 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP61_RS04055 (784566) | 784566..784889 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
| QJP61_RS04060 (784990) | 784990..785319 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP61_RS04065 (785491) | 785491..786549 | - | 1059 | WP_001200889.1 | FUSC family protein | - |
| QJP61_RS04070 (786747) | 786747..787220 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
| QJP61_RS04075 (787277) | 787277..788497 | - | 1221 | WP_000343765.1 | ISL3-like element ISEc53 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T280083 WP_000854815.1 NZ_CP124410:783527-783901 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |