Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 783070..783901 Replicon chromosome
Accession NZ_CP124410
Organism Escherichia coli strain AVS0543

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP61_RS04035 Protein ID WP_000854815.1
Coordinates 783527..783901 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP61_RS04030 Protein ID WP_001280918.1
Coordinates 783070..783438 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP61_RS03985 (778159) 778159..778905 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP61_RS03990 (778988) 778988..779338 + 351 Protein_786 hypothetical protein -
QJP61_RS03995 (779354) 779354..779764 + 411 WP_000846703.1 hypothetical protein -
QJP61_RS04000 (779985) 779985..780803 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP61_RS04005 (780803) 780803..781048 + 246 WP_001164966.1 hypothetical protein -
QJP61_RS04010 (781142) 781142..781615 + 474 WP_001542276.1 antirestriction protein -
QJP61_RS04015 (781631) 781631..782107 + 477 WP_059333688.1 RadC family protein -
QJP61_RS04020 (782170) 782170..782391 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP61_RS04025 (782410) 782410..783054 + 645 WP_000086752.1 hypothetical protein -
QJP61_RS04030 (783070) 783070..783438 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP61_RS04035 (783527) 783527..783901 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP61_RS04040 (783898) 783898..784092 + 195 WP_000988600.1 DUF5983 family protein -
QJP61_RS04045 (784138) 784138..784218 + 81 Protein_797 hypothetical protein -
QJP61_RS04050 (784507) 784507..784587 - 81 WP_023441679.1 hypothetical protein -
QJP61_RS04055 (784566) 784566..784889 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP61_RS04060 (784990) 784990..785319 - 330 WP_000450409.1 DUF496 family protein -
QJP61_RS04065 (785491) 785491..786549 - 1059 WP_001200889.1 FUSC family protein -
QJP61_RS04070 (786747) 786747..787220 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP61_RS04075 (787277) 787277..788497 - 1221 WP_000343765.1 ISL3-like element ISEc53 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280083 WP_000854815.1 NZ_CP124410:783527-783901 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280083 WP_001280918.1 NZ_CP124410:783070-783438 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References