Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 82609..83210 Replicon plasmid pAVS0935-A
Accession NZ_CP124406
Organism Escherichia coli strain AVS0935

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJB05_RS24385 Protein ID WP_001216034.1
Coordinates 82830..83210 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJB05_RS24380 Protein ID WP_001190712.1
Coordinates 82609..82830 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB05_RS24370 (79602) 79602..80873 - 1272 WP_023142242.1 restriction endonuclease subunit S -
QJB05_RS24375 (80870) 80870..82426 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJB05_RS24380 (82609) 82609..82830 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJB05_RS24385 (82830) 82830..83210 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJB05_RS24390 (83215) 83215..83394 + 180 WP_001513661.1 hypothetical protein -
QJB05_RS24395 (83422) 83422..83700 + 279 Protein_101 pdcB -
QJB05_RS24400 (83705) 83705..84118 + 414 Protein_102 integrase core domain-containing protein -
QJB05_RS24405 (84068) 84068..84403 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJB05_RS24410 (84613) 84613..85593 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJB05_RS24415 (85837) 85837..87240 + 1404 WP_001373486.1 S-methylmethionine permease -
QJB05_RS24420 (87227) 87227..88159 + 933 WP_283187966.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 - 1..91501 91501


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280073 WP_001216034.1 NZ_CP124406:82830-83210 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280073 WP_001190712.1 NZ_CP124406:82609-82830 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References