Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 72152..72677 | Replicon | plasmid pAVS0935-A |
| Accession | NZ_CP124406 | ||
| Organism | Escherichia coli strain AVS0935 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QJB05_RS24340 | Protein ID | WP_001159868.1 |
| Coordinates | 72152..72457 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QJB05_RS24345 | Protein ID | WP_000813634.1 |
| Coordinates | 72459..72677 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB05_RS24325 (68062) | 68062..69228 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QJB05_RS24330 (69816) | 69816..70571 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJB05_RS24335 (71345) | 71345..72151 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| QJB05_RS24340 (72152) | 72152..72457 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJB05_RS24345 (72459) | 72459..72677 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJB05_RS24350 (73385) | 73385..74380 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| QJB05_RS24355 (74423) | 74423..75316 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 1..91501 | 91501 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280072 WP_001159868.1 NZ_CP124406:c72457-72152 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|