Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3994226..3994844 | Replicon | chromosome |
| Accession | NZ_CP124405 | ||
| Organism | Escherichia coli strain AVS0935 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJB05_RS19145 | Protein ID | WP_001291435.1 |
| Coordinates | 3994226..3994444 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJB05_RS19150 | Protein ID | WP_000344800.1 |
| Coordinates | 3994470..3994844 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB05_RS19110 (3989513) | 3989513..3990085 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| QJB05_RS19115 (3990116) | 3990116..3990427 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| QJB05_RS19125 (3990806) | 3990806..3991159 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
| QJB05_RS19130 (3991201) | 3991201..3992751 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJB05_RS19135 (3992915) | 3992915..3993385 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| QJB05_RS19140 (3993501) | 3993501..3994052 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJB05_RS19145 (3994226) | 3994226..3994444 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJB05_RS19150 (3994470) | 3994470..3994844 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJB05_RS19155 (3995390) | 3995390..3998539 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJB05_RS19160 (3998562) | 3998562..3999755 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280062 WP_001291435.1 NZ_CP124405:c3994444-3994226 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280062 WP_000344800.1 NZ_CP124405:c3994844-3994470 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |