Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 777750..778581 Replicon chromosome
Accession NZ_CP124405
Organism Escherichia coli strain AVS0935

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJB05_RS03980 Protein ID WP_000854815.1
Coordinates 778207..778581 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJB05_RS03975 Protein ID WP_001280918.1
Coordinates 777750..778118 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB05_RS03930 (772839) 772839..773585 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB05_RS03935 (773668) 773668..774018 + 351 Protein_775 hypothetical protein -
QJB05_RS03940 (774034) 774034..774444 + 411 WP_000846703.1 hypothetical protein -
QJB05_RS03945 (774665) 774665..775483 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJB05_RS03950 (775483) 775483..775728 + 246 WP_001164966.1 hypothetical protein -
QJB05_RS03955 (775822) 775822..776295 + 474 WP_001542276.1 antirestriction protein -
QJB05_RS03960 (776311) 776311..776787 + 477 WP_001186200.1 RadC family protein -
QJB05_RS03965 (776850) 776850..777071 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJB05_RS03970 (777090) 777090..777734 + 645 WP_000086752.1 hypothetical protein -
QJB05_RS03975 (777750) 777750..778118 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJB05_RS03980 (778207) 778207..778581 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB05_RS03985 (778578) 778578..778772 + 195 WP_000988600.1 DUF5983 family protein -
QJB05_RS03990 (778818) 778818..778898 + 81 Protein_786 hypothetical protein -
QJB05_RS03995 (779187) 779187..779267 - 81 WP_023441679.1 hypothetical protein -
QJB05_RS04000 (779246) 779246..779569 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJB05_RS04005 (779670) 779670..779999 - 330 WP_000450409.1 DUF496 family protein -
QJB05_RS04010 (780171) 780171..781229 - 1059 WP_001200889.1 FUSC family protein -
QJB05_RS04015 (781427) 781427..781900 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJB05_RS04020 (782019) 782019..783185 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280049 WP_000854815.1 NZ_CP124405:778207-778581 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280049 WP_001280918.1 NZ_CP124405:777750-778118 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References