Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 88811..89412 Replicon plasmid pAVS0528-A
Accession NZ_CP124401
Organism Escherichia coli strain AVS0528

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJP80_RS24705 Protein ID WP_001216034.1
Coordinates 89032..89412 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJP80_RS24700 Protein ID WP_001190712.1
Coordinates 88811..89032 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP80_RS24690 (85792) 85792..87075 - 1284 WP_001617890.1 restriction endonuclease subunit S -
QJP80_RS24695 (87072) 87072..88628 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QJP80_RS24700 (88811) 88811..89032 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJP80_RS24705 (89032) 89032..89412 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJP80_RS24710 (89417) 89417..89596 + 180 WP_001513661.1 hypothetical protein -
QJP80_RS24715 (89624) 89624..89902 + 279 Protein_98 pdcB -
QJP80_RS24720 (89907) 89907..90320 + 414 Protein_99 integrase core domain-containing protein -
QJP80_RS24725 (90270) 90270..90605 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJP80_RS24730 (90815) 90815..91795 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJP80_RS24735 (92039) 92039..93442 + 1404 WP_001373486.1 S-methylmethionine permease -
QJP80_RS24740 (93429) 93429..94361 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-27 senB 1..97703 97703


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280043 WP_001216034.1 NZ_CP124401:89032-89412 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280043 WP_001190712.1 NZ_CP124401:88811-89032 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References