Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 78342..78867 | Replicon | plasmid pAVS0528-A |
Accession | NZ_CP124401 | ||
Organism | Escherichia coli strain AVS0528 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QJP80_RS24660 | Protein ID | WP_001159868.1 |
Coordinates | 78342..78647 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QJP80_RS24665 | Protein ID | WP_000813634.1 |
Coordinates | 78649..78867 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP80_RS24645 (74252) | 74252..75418 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QJP80_RS24650 (76006) | 76006..76761 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP80_RS24655 (77535) | 77535..78341 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QJP80_RS24660 (78342) | 78342..78647 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJP80_RS24665 (78649) | 78649..78867 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJP80_RS24670 (79575) | 79575..80570 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QJP80_RS24675 (80613) | 80613..81506 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-27 | senB | 1..97703 | 97703 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280042 WP_001159868.1 NZ_CP124401:c78647-78342 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|