Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3438083..3438918 | Replicon | chromosome |
| Accession | NZ_CP124400 | ||
| Organism | Escherichia coli strain AVS0528 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP80_RS16505 | Protein ID | WP_000854759.1 |
| Coordinates | 3438541..3438918 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP80_RS16500 | Protein ID | WP_001295723.1 |
| Coordinates | 3438083..3438451 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP80_RS16470 (3433394) | 3433394..3435127 | + | 1734 | Protein_3216 | Ag43/Cah family autotransporter adhesin | - |
| QJP80_RS16475 (3435198) | 3435198..3435393 | + | 196 | Protein_3217 | DUF905 family protein | - |
| QJP80_RS16480 (3435511) | 3435511..3436329 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP80_RS16485 (3436671) | 3436671..3437144 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP80_RS16490 (3437160) | 3437160..3437636 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJP80_RS16495 (3437699) | 3437699..3437920 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP80_RS16500 (3438083) | 3438083..3438451 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP80_RS16505 (3438541) | 3438541..3438918 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP80_RS16510 (3438915) | 3438915..3439403 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP80_RS16515 (3439420) | 3439420..3439596 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP80_RS16520 (3439702) | 3439702..3439851 | + | 150 | Protein_3226 | hypothetical protein | - |
| QJP80_RS16525 (3440218) | 3440218..3440523 | + | 306 | Protein_3227 | helix-turn-helix domain-containing protein | - |
| QJP80_RS16530 (3441185) | 3441185..3442807 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T280028 WP_000854759.1 NZ_CP124400:3438541-3438918 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT280028 WP_001295723.1 NZ_CP124400:3438083-3438451 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |