Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1855529..1856363 Replicon chromosome
Accession NZ_CP124400
Organism Escherichia coli strain AVS0528

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP80_RS08955 Protein ID WP_000854690.1
Coordinates 1855986..1856363 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP80_RS08950 Protein ID WP_001305076.1
Coordinates 1855529..1855897 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP80_RS08910 (1850611) 1850611..1851738 + 1128 Protein_1749 hypothetical protein -
QJP80_RS08915 (1851814) 1851814..1852269 + 456 WP_000581502.1 IrmA family protein -
QJP80_RS08920 (1852348) 1852348..1852581 + 234 WP_000902034.1 DUF905 family protein -
QJP80_RS08925 (1852682) 1852682..1853500 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP80_RS08930 (1853555) 1853555..1854040 + 486 WP_000849565.1 antirestriction protein -
QJP80_RS08935 (1854056) 1854056..1854532 + 477 WP_001186726.1 RadC family protein -
QJP80_RS08940 (1854595) 1854595..1854816 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP80_RS08945 (1854835) 1854835..1855479 + 645 WP_000094916.1 hypothetical protein -
QJP80_RS08950 (1855529) 1855529..1855897 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP80_RS08955 (1855986) 1855986..1856363 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP80_RS08960 (1856360) 1856360..1856848 + 489 WP_000761699.1 DUF5983 family protein -
QJP80_RS08965 (1856865) 1856865..1857062 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP80_RS08970 (1857147) 1857147..1857992 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP80_RS08975 (1858061) 1858061..1858456 + 396 WP_000208384.1 DUF6088 family protein -
QJP80_RS08980 (1858449) 1858449..1859382 + 934 Protein_1763 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP80_RS08985 (1859799) 1859799..1859969 + 171 Protein_1764 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT 1811252..1873940 62688
- flank IS/Tn - - 1859814..1859969 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T280021 WP_000854690.1 NZ_CP124400:1855986-1856363 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT280021 WP_001305076.1 NZ_CP124400:1855529-1855897 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References