Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1855529..1856363 | Replicon | chromosome |
| Accession | NZ_CP124400 | ||
| Organism | Escherichia coli strain AVS0528 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QJP80_RS08955 | Protein ID | WP_000854690.1 |
| Coordinates | 1855986..1856363 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | QJP80_RS08950 | Protein ID | WP_001305076.1 |
| Coordinates | 1855529..1855897 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP80_RS08910 (1850611) | 1850611..1851738 | + | 1128 | Protein_1749 | hypothetical protein | - |
| QJP80_RS08915 (1851814) | 1851814..1852269 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QJP80_RS08920 (1852348) | 1852348..1852581 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| QJP80_RS08925 (1852682) | 1852682..1853500 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP80_RS08930 (1853555) | 1853555..1854040 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| QJP80_RS08935 (1854056) | 1854056..1854532 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QJP80_RS08940 (1854595) | 1854595..1854816 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QJP80_RS08945 (1854835) | 1854835..1855479 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QJP80_RS08950 (1855529) | 1855529..1855897 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP80_RS08955 (1855986) | 1855986..1856363 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QJP80_RS08960 (1856360) | 1856360..1856848 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| QJP80_RS08965 (1856865) | 1856865..1857062 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QJP80_RS08970 (1857147) | 1857147..1857992 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QJP80_RS08975 (1858061) | 1858061..1858456 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QJP80_RS08980 (1858449) | 1858449..1859382 | + | 934 | Protein_1763 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP80_RS08985 (1859799) | 1859799..1859969 | + | 171 | Protein_1764 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT | 1811252..1873940 | 62688 | |
| - | flank | IS/Tn | - | - | 1859814..1859969 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T280021 WP_000854690.1 NZ_CP124400:1855986-1856363 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT280021 WP_001305076.1 NZ_CP124400:1855529-1855897 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|