Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1710617..1711271 | Replicon | chromosome |
Accession | NZ_CP124400 | ||
Organism | Escherichia coli strain AVS0528 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | QJP80_RS08175 | Protein ID | WP_000244765.1 |
Coordinates | 1710617..1711024 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | QJP80_RS08180 | Protein ID | WP_000354050.1 |
Coordinates | 1711005..1711271 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP80_RS08155 (1706574) | 1706574..1708307 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QJP80_RS08160 (1708313) | 1708313..1709023 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QJP80_RS08165 (1709048) | 1709048..1709944 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QJP80_RS08170 (1710056) | 1710056..1710577 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
QJP80_RS08175 (1710617) | 1710617..1711024 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
QJP80_RS08180 (1711005) | 1711005..1711271 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
QJP80_RS08185 (1711514) | 1711514..1712494 | + | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
QJP80_RS08190 (1712571) | 1712571..1713230 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
QJP80_RS08195 (1713394) | 1713394..1713705 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QJP80_RS08200 (1713750) | 1713750..1715183 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T280020 WP_000244765.1 NZ_CP124400:c1711024-1710617 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |