Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 777495..778326 Replicon chromosome
Accession NZ_CP124400
Organism Escherichia coli strain AVS0528

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP80_RS03980 Protein ID WP_000854815.1
Coordinates 777952..778326 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP80_RS03975 Protein ID WP_001280918.1
Coordinates 777495..777863 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP80_RS03930 (772584) 772584..773330 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP80_RS03935 (773413) 773413..773763 + 351 Protein_775 hypothetical protein -
QJP80_RS03940 (773779) 773779..774189 + 411 WP_000846703.1 hypothetical protein -
QJP80_RS03945 (774410) 774410..775228 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP80_RS03950 (775228) 775228..775473 + 246 WP_001164966.1 hypothetical protein -
QJP80_RS03955 (775567) 775567..776040 + 474 WP_001542276.1 antirestriction protein -
QJP80_RS03960 (776056) 776056..776532 + 477 WP_001186200.1 RadC family protein -
QJP80_RS03965 (776595) 776595..776816 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP80_RS03970 (776835) 776835..777479 + 645 WP_000086752.1 hypothetical protein -
QJP80_RS03975 (777495) 777495..777863 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP80_RS03980 (777952) 777952..778326 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP80_RS03985 (778323) 778323..778517 + 195 WP_000988600.1 DUF5983 family protein -
QJP80_RS03990 (778563) 778563..778643 + 81 Protein_786 hypothetical protein -
QJP80_RS03995 (778932) 778932..779012 - 81 WP_023441679.1 hypothetical protein -
QJP80_RS04000 (778991) 778991..779314 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP80_RS04005 (779415) 779415..779744 - 330 WP_000450409.1 DUF496 family protein -
QJP80_RS04010 (779916) 779916..780974 - 1059 WP_001200889.1 FUSC family protein -
QJP80_RS04015 (781172) 781172..781645 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP80_RS04020 (781764) 781764..782930 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T280018 WP_000854815.1 NZ_CP124400:777952-778326 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT280018 WP_001280918.1 NZ_CP124400:777495-777863 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References