Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 31664..32129 Replicon plasmid pAVS0972-B
Accession NZ_CP124389
Organism Escherichia coli strain AVS0972

Toxin (Protein)


Gene name TsxA Uniprot ID M7C8T2
Locus tag QJB01_RS25345 Protein ID WP_001230706.1
Coordinates 31664..31912 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag QJB01_RS25350 Protein ID WP_000801440.1
Coordinates 31902..32129 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB01_RS25315 (QJB01_25315) 26749..27195 - 447 WP_109537466.1 hypothetical protein -
QJB01_RS25320 (QJB01_25320) 27204..28196 - 993 WP_004239667.1 replication initiation protein -
QJB01_RS25325 (QJB01_25325) 29189..29524 + 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -
QJB01_RS25330 (QJB01_25330) 29521..29871 + 351 WP_000127482.1 addiction module antitoxin -
QJB01_RS25335 (QJB01_25335) 30505..31020 + 516 WP_001547177.1 J domain-containing protein -
QJB01_RS25340 (QJB01_25340) 31125..31667 + 543 WP_001083906.1 hypothetical protein -
QJB01_RS25345 (QJB01_25345) 31664..31912 + 249 WP_001230706.1 hypothetical protein Toxin
QJB01_RS25350 (QJB01_25350) 31902..32129 + 228 WP_000801440.1 hypothetical protein Antitoxin
QJB01_RS25355 (QJB01_25355) 32577..32876 + 300 WP_000650311.1 hypothetical protein -
QJB01_RS25360 (QJB01_25360) 32928..33302 + 375 WP_000844303.1 tail-associated lysozyme -
QJB01_RS25365 (QJB01_25365) 33317..33610 + 294 WP_021568250.1 hypothetical protein -
QJB01_RS25370 (QJB01_25370) 33679..33828 + 150 WP_000003876.1 hypothetical protein -
QJB01_RS25375 (QJB01_25375) 33841..34113 + 273 WP_001363158.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..34433 34433


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9594.94 Da        Isoelectric Point: 7.9925

>T280012 WP_001230706.1 NZ_CP124389:31664-31912 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ET

Download         Length: 249 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT280012 WP_000801440.1 NZ_CP124389:31902-32129 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7C8T2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References