Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 94560..95161 Replicon plasmid pAVS0972-A
Accession NZ_CP124388
Organism Escherichia coli strain AVS0972

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QJB01_RS25085 Protein ID WP_001216034.1
Coordinates 94781..95161 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QJB01_RS25080 Protein ID WP_001190712.1
Coordinates 94560..94781 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB01_RS25060 (90088) 90088..91083 + 996 WP_000246636.1 hypothetical protein -
QJB01_RS25065 (91126) 91126..92019 + 894 WP_001553853.1 S-4TM family putative pore-forming effector -
QJB01_RS25075 (92887) 92887..94377 - 1491 WP_171876359.1 type I restriction-modification system subunit M -
QJB01_RS25080 (94560) 94560..94781 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJB01_RS25085 (94781) 94781..95161 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJB01_RS25090 (95166) 95166..95345 + 180 WP_001513661.1 hypothetical protein -
QJB01_RS25095 (95373) 95373..95651 + 279 Protein_108 pdcB -
QJB01_RS25100 (95656) 95656..96069 + 414 Protein_109 integrase core domain-containing protein -
QJB01_RS25105 (96019) 96019..96354 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QJB01_RS25110 (96564) 96564..97544 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QJB01_RS25115 (97788) 97788..99191 + 1404 WP_001373486.1 S-methylmethionine permease -
QJB01_RS25120 (99178) 99178..100110 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-27 senB 1..103452 103452
- inside IScluster/Tn - - 92156..100941 8785


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T280011 WP_001216034.1 NZ_CP124388:94781-95161 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT280011 WP_001190712.1 NZ_CP124388:94560-94781 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References