Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 88855..89380 | Replicon | plasmid pAVS0972-A |
Accession | NZ_CP124388 | ||
Organism | Escherichia coli strain AVS0972 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QJB01_RS25050 | Protein ID | WP_001159868.1 |
Coordinates | 88855..89160 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QJB01_RS25055 | Protein ID | WP_000813634.1 |
Coordinates | 89162..89380 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB01_RS25035 (84765) | 84765..85931 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QJB01_RS25040 (86519) | 86519..87274 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJB01_RS25045 (88048) | 88048..88854 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QJB01_RS25050 (88855) | 88855..89160 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJB01_RS25055 (89162) | 89162..89380 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJB01_RS25060 (90088) | 90088..91083 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QJB01_RS25065 (91126) | 91126..92019 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
QJB01_RS25075 (92887) | 92887..94377 | - | 1491 | WP_171876359.1 | type I restriction-modification system subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-27 | senB | 1..103452 | 103452 | |
- | inside | IScluster/Tn | - | - | 92156..100941 | 8785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T280010 WP_001159868.1 NZ_CP124388:c89160-88855 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|