Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4119788..4120406 | Replicon | chromosome |
Accession | NZ_CP124387 | ||
Organism | Escherichia coli strain AVS0972 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJB01_RS19840 | Protein ID | WP_001291435.1 |
Coordinates | 4119788..4120006 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJB01_RS19845 | Protein ID | WP_000344800.1 |
Coordinates | 4120032..4120406 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB01_RS19805 (4115075) | 4115075..4115647 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QJB01_RS19810 (4115678) | 4115678..4115989 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QJB01_RS19820 (4116368) | 4116368..4116721 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
QJB01_RS19825 (4116763) | 4116763..4118313 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJB01_RS19830 (4118477) | 4118477..4118947 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QJB01_RS19835 (4119063) | 4119063..4119614 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJB01_RS19840 (4119788) | 4119788..4120006 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJB01_RS19845 (4120032) | 4120032..4120406 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJB01_RS19850 (4120952) | 4120952..4124101 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJB01_RS19855 (4124124) | 4124124..4125317 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T280000 WP_001291435.1 NZ_CP124387:c4120006-4119788 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT280000 WP_000344800.1 NZ_CP124387:c4120406-4120032 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |