Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3667424..3667944 Replicon chromosome
Accession NZ_CP124387
Organism Escherichia coli strain AVS0972

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJB01_RS17675 Protein ID WP_001160964.1
Coordinates 3667660..3667944 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJB01_RS17670 Protein ID WP_000125566.1
Coordinates 3667424..3667657 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB01_RS17645 (3662497) 3662497..3662784 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJB01_RS17650 (3662843) 3662843..3664174 + 1332 WP_001183209.1 MFS transporter -
QJB01_RS17655 (3664282) 3664282..3664812 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJB01_RS17660 (3664805) 3664805..3666667 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJB01_RS17665 (3666859) 3666859..3667338 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJB01_RS17670 (3667424) 3667424..3667657 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJB01_RS17675 (3667660) 3667660..3667944 + 285 WP_001160964.1 CcdB family protein Toxin
QJB01_RS17680 (3667971) 3667971..3668819 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJB01_RS17685 (3668826) 3668826..3669203 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJB01_RS17690 (3669206) 3669206..3670027 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJB01_RS17695 (3670024) 3670024..3671013 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJB01_RS17700 (3671013) 3671013..3672299 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T279998 WP_001160964.1 NZ_CP124387:3667660-3667944 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279998 WP_000125566.1 NZ_CP124387:3667424-3667657 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References