Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3475300..3476135 | Replicon | chromosome |
| Accession | NZ_CP124387 | ||
| Organism | Escherichia coli strain AVS0972 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJB01_RS16755 | Protein ID | WP_000854759.1 |
| Coordinates | 3475758..3476135 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJB01_RS16750 | Protein ID | WP_001295723.1 |
| Coordinates | 3475300..3475668 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB01_RS16725 (3472415) | 3472415..3472610 | + | 196 | Protein_3268 | DUF905 family protein | - |
| QJB01_RS16730 (3472728) | 3472728..3473546 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJB01_RS16735 (3473888) | 3473888..3474361 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJB01_RS16740 (3474377) | 3474377..3474853 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJB01_RS16745 (3474916) | 3474916..3475137 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJB01_RS16750 (3475300) | 3475300..3475668 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB01_RS16755 (3475758) | 3475758..3476135 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJB01_RS16760 (3476132) | 3476132..3476620 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJB01_RS16765 (3476637) | 3476637..3476813 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJB01_RS16770 (3476919) | 3476919..3477068 | + | 150 | Protein_3277 | hypothetical protein | - |
| QJB01_RS16775 (3477435) | 3477435..3477611 | + | 177 | Protein_3278 | helix-turn-helix domain-containing protein | - |
| QJB01_RS16780 (3478402) | 3478402..3480024 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3461606..3489091 | 27485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279996 WP_000854759.1 NZ_CP124387:3475758-3476135 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT279996 WP_001295723.1 NZ_CP124387:3475300-3475668 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |