Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2691349..2692183 | Replicon | chromosome |
| Accession | NZ_CP124387 | ||
| Organism | Escherichia coli strain AVS0972 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E0IWF2 |
| Locus tag | QJB01_RS13055 | Protein ID | WP_001521667.1 |
| Coordinates | 2691806..2692183 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | QJB01_RS13050 | Protein ID | WP_001285610.1 |
| Coordinates | 2691349..2691717 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB01_RS13015 (2687481) | 2687481..2687912 | + | 432 | Protein_2558 | WYL domain-containing protein | - |
| QJB01_RS13020 (2688060) | 2688060..2688737 | + | 678 | WP_282517533.1 | hypothetical protein | - |
| QJB01_RS13025 (2688743) | 2688743..2688976 | + | 234 | WP_001521659.1 | DUF905 family protein | - |
| QJB01_RS13030 (2689075) | 2689075..2689893 | + | 819 | WP_021524626.1 | DUF932 domain-containing protein | - |
| QJB01_RS13035 (2689985) | 2689985..2690470 | + | 486 | WP_021524627.1 | antirestriction protein | - |
| QJB01_RS13040 (2690486) | 2690486..2690962 | + | 477 | WP_001186724.1 | RadC family protein | - |
| QJB01_RS13045 (2691048) | 2691048..2691269 | + | 222 | WP_001521666.1 | DUF987 domain-containing protein | - |
| QJB01_RS13050 (2691349) | 2691349..2691717 | + | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB01_RS13055 (2691806) | 2691806..2692183 | + | 378 | WP_001521667.1 | TA system toxin CbtA family protein | Toxin |
| QJB01_RS13060 (2692180) | 2692180..2692329 | + | 150 | Protein_2567 | DUF5983 family protein | - |
| QJB01_RS13065 (2692405) | 2692405..2692602 | + | 198 | WP_086795284.1 | DUF957 domain-containing protein | - |
| QJB01_RS13070 (2692687) | 2692687..2693529 | + | 843 | WP_001521669.1 | DUF4942 domain-containing protein | - |
| QJB01_RS13075 (2694125) | 2694125..2694622 | + | 498 | WP_000509815.1 | hypothetical protein | - |
| QJB01_RS13080 (2694800) | 2694800..2695723 | + | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| QJB01_RS13085 (2695727) | 2695727..2696545 | - | 819 | WP_000779409.1 | lipoprotein NlpA | - |
| QJB01_RS13090 (2696767) | 2696767..2697060 | + | 294 | WP_001296563.1 | protein YicS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14035.97 Da Isoelectric Point: 6.8607
>T279992 WP_001521667.1 NZ_CP124387:2691806-2692183 [Escherichia coli]
MKTLPVLPGQAASSRPSSVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTHSQLINSIDILRARRATGLMTRDNYRMVNDISQGKHPEAKQ
MKTLPVLPGQAASSRPSSVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTHSQLINSIDILRARRATGLMTRDNYRMVNDISQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT279992 WP_001285610.1 NZ_CP124387:2691349-2691717 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|