Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2392706..2393506 | Replicon | chromosome |
| Accession | NZ_CP124387 | ||
| Organism | Escherichia coli strain AVS0972 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4T503 |
| Locus tag | QJB01_RS11640 | Protein ID | WP_000342452.1 |
| Coordinates | 2392706..2393233 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4T504 |
| Locus tag | QJB01_RS11645 | Protein ID | WP_001277107.1 |
| Coordinates | 2393240..2393506 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB01_RS11615 (2387782) | 2387782..2388549 | - | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QJB01_RS11620 (2388546) | 2388546..2389823 | - | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
| QJB01_RS11625 (2389820) | 2389820..2390746 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QJB01_RS11630 (2390794) | 2390794..2391903 | - | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| QJB01_RS11635 (2392326) | 2392326..2392709 | + | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| QJB01_RS11640 (2392706) | 2392706..2393233 | - | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| QJB01_RS11645 (2393240) | 2393240..2393506 | - | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| QJB01_RS11650 (2393655) | 2393655..2394758 | - | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| QJB01_RS11655 (2395029) | 2395029..2395883 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| QJB01_RS11660 (2396128) | 2396128..2397186 | - | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
| QJB01_RS11665 (2397179) | 2397179..2397847 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T279991 WP_000342452.1 NZ_CP124387:c2393233-2392706 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061K5K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061YQ57 |