Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1860181..1861015 Replicon chromosome
Accession NZ_CP124387
Organism Escherichia coli strain AVS0972

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJB01_RS08985 Protein ID WP_000854690.1
Coordinates 1860638..1861015 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJB01_RS08980 Protein ID WP_001305076.1
Coordinates 1860181..1860549 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB01_RS08940 (1855263) 1855263..1856390 + 1128 Protein_1754 hypothetical protein -
QJB01_RS08945 (1856466) 1856466..1856921 + 456 WP_000581502.1 IrmA family protein -
QJB01_RS08950 (1857000) 1857000..1857233 + 234 WP_000902034.1 DUF905 family protein -
QJB01_RS08955 (1857334) 1857334..1858152 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJB01_RS08960 (1858207) 1858207..1858692 + 486 WP_000849565.1 antirestriction protein -
QJB01_RS08965 (1858708) 1858708..1859184 + 477 WP_001186726.1 RadC family protein -
QJB01_RS08970 (1859247) 1859247..1859468 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJB01_RS08975 (1859487) 1859487..1860131 + 645 WP_000094916.1 hypothetical protein -
QJB01_RS08980 (1860181) 1860181..1860549 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJB01_RS08985 (1860638) 1860638..1861015 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJB01_RS08990 (1861012) 1861012..1861500 + 489 WP_000761699.1 DUF5983 family protein -
QJB01_RS08995 (1861517) 1861517..1861714 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJB01_RS09000 (1861799) 1861799..1862644 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJB01_RS09005 (1862713) 1862713..1863108 + 396 WP_000208384.1 DUF6088 family protein -
QJB01_RS09010 (1863101) 1863101..1864034 + 934 Protein_1768 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJB01_RS09015 (1864451) 1864451..1864621 + 171 Protein_1769 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 1847325..1882053 34728
- flank IS/Tn - - 1864466..1864621 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T279988 WP_000854690.1 NZ_CP124387:1860638-1861015 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT279988 WP_001305076.1 NZ_CP124387:1860181-1860549 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References