Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 777675..778506 | Replicon | chromosome |
| Accession | NZ_CP124387 | ||
| Organism | Escherichia coli strain AVS0972 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | QJB01_RS03980 | Protein ID | WP_000854815.1 |
| Coordinates | 778132..778506 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | QJB01_RS03975 | Protein ID | WP_001280918.1 |
| Coordinates | 777675..778043 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB01_RS03930 (772764) | 772764..773510 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJB01_RS03935 (773593) | 773593..773943 | + | 351 | Protein_775 | hypothetical protein | - |
| QJB01_RS03940 (773959) | 773959..774369 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| QJB01_RS03945 (774590) | 774590..775408 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| QJB01_RS03950 (775408) | 775408..775653 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| QJB01_RS03955 (775747) | 775747..776220 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| QJB01_RS03960 (776236) | 776236..776712 | + | 477 | WP_001186200.1 | RadC family protein | - |
| QJB01_RS03965 (776775) | 776775..776996 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJB01_RS03970 (777015) | 777015..777659 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| QJB01_RS03975 (777675) | 777675..778043 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB01_RS03980 (778132) | 778132..778506 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJB01_RS03985 (778503) | 778503..778697 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QJB01_RS03990 (778743) | 778743..778823 | + | 81 | Protein_786 | hypothetical protein | - |
| QJB01_RS03995 (779112) | 779112..779192 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| QJB01_RS04000 (779171) | 779171..779494 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
| QJB01_RS04005 (779595) | 779595..779924 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJB01_RS04010 (780096) | 780096..781154 | - | 1059 | Protein_790 | FUSC family protein | - |
| QJB01_RS04015 (781352) | 781352..781825 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
| QJB01_RS04020 (781882) | 781882..783102 | - | 1221 | WP_000343765.1 | ISL3-like element ISEc53 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T279985 WP_000854815.1 NZ_CP124387:778132-778506 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |