Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 777675..778506 Replicon chromosome
Accession NZ_CP124387
Organism Escherichia coli strain AVS0972

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJB01_RS03980 Protein ID WP_000854815.1
Coordinates 778132..778506 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJB01_RS03975 Protein ID WP_001280918.1
Coordinates 777675..778043 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB01_RS03930 (772764) 772764..773510 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB01_RS03935 (773593) 773593..773943 + 351 Protein_775 hypothetical protein -
QJB01_RS03940 (773959) 773959..774369 + 411 WP_000846703.1 hypothetical protein -
QJB01_RS03945 (774590) 774590..775408 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJB01_RS03950 (775408) 775408..775653 + 246 WP_001164966.1 hypothetical protein -
QJB01_RS03955 (775747) 775747..776220 + 474 WP_001542276.1 antirestriction protein -
QJB01_RS03960 (776236) 776236..776712 + 477 WP_001186200.1 RadC family protein -
QJB01_RS03965 (776775) 776775..776996 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJB01_RS03970 (777015) 777015..777659 + 645 WP_000086752.1 hypothetical protein -
QJB01_RS03975 (777675) 777675..778043 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJB01_RS03980 (778132) 778132..778506 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB01_RS03985 (778503) 778503..778697 + 195 WP_000988600.1 DUF5983 family protein -
QJB01_RS03990 (778743) 778743..778823 + 81 Protein_786 hypothetical protein -
QJB01_RS03995 (779112) 779112..779192 - 81 WP_023441679.1 hypothetical protein -
QJB01_RS04000 (779171) 779171..779494 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJB01_RS04005 (779595) 779595..779924 - 330 WP_000450409.1 DUF496 family protein -
QJB01_RS04010 (780096) 780096..781154 - 1059 Protein_790 FUSC family protein -
QJB01_RS04015 (781352) 781352..781825 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJB01_RS04020 (781882) 781882..783102 - 1221 WP_000343765.1 ISL3-like element ISEc53 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279985 WP_000854815.1 NZ_CP124387:778132-778506 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279985 WP_001280918.1 NZ_CP124387:777675-778043 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References