Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 98555..99198 | Replicon | plasmid pAVS0153-A |
| Accession | NZ_CP124386 | ||
| Organism | Escherichia coli strain AVS0153 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QJP67_RS26800 | Protein ID | WP_001034044.1 |
| Coordinates | 98782..99198 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QJP67_RS26795 | Protein ID | WP_001261286.1 |
| Coordinates | 98555..98785 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP67_RS26775 (95186) | 95186..95941 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP67_RS26780 (96663) | 96663..97469 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| QJP67_RS26785 (97470) | 97470..97775 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| QJP67_RS26790 (97777) | 97777..97995 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| QJP67_RS26795 (98555) | 98555..98785 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJP67_RS26800 (98782) | 98782..99198 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJP67_RS26805 (99273) | 99273..100838 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QJP67_RS26810 (100823) | 100823..101845 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| QJP67_RS26815 (102142) | 102142..102474 | - | 333 | WP_263974601.1 | IS1 family transposase | - |
| QJP67_RS26820 (102494) | 102494..102793 | - | 300 | WP_001340944.1 | IS1-like element transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iutA / iutA / iutA / iucD | 1..108862 | 108862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T279979 WP_001034044.1 NZ_CP124386:98782-99198 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |