Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 97470..97995 Replicon plasmid pAVS0153-A
Accession NZ_CP124386
Organism Escherichia coli strain AVS0153

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QJP67_RS26785 Protein ID WP_001159871.1
Coordinates 97470..97775 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QJP67_RS26790 Protein ID WP_000813630.1
Coordinates 97777..97995 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP67_RS26770 (93432) 93432..94598 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
QJP67_RS26775 (95186) 95186..95941 - 756 WP_000852146.1 replication initiation protein RepE -
QJP67_RS26780 (96663) 96663..97469 - 807 WP_000016970.1 site-specific integrase -
QJP67_RS26785 (97470) 97470..97775 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QJP67_RS26790 (97777) 97777..97995 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QJP67_RS26795 (98555) 98555..98785 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QJP67_RS26800 (98782) 98782..99198 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QJP67_RS26805 (99273) 99273..100838 + 1566 WP_001128474.1 AAA family ATPase -
QJP67_RS26810 (100823) 100823..101845 + 1023 WP_000361402.1 helicase UvrD -
QJP67_RS26815 (102142) 102142..102474 - 333 WP_263974601.1 IS1 family transposase -
QJP67_RS26820 (102494) 102494..102793 - 300 WP_001340944.1 IS1-like element transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - iutA / iutA / iutA / iutA / iucD 1..108862 108862


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T279978 WP_001159871.1 NZ_CP124386:c97775-97470 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT279978 WP_000813630.1 NZ_CP124386:c97995-97777 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References