Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4330161..4330779 | Replicon | chromosome |
Accession | NZ_CP124385 | ||
Organism | Escherichia coli strain AVS0153 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJP67_RS21215 | Protein ID | WP_001291435.1 |
Coordinates | 4330161..4330379 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJP67_RS21220 | Protein ID | WP_000344800.1 |
Coordinates | 4330405..4330779 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP67_RS21180 (4325448) | 4325448..4326020 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QJP67_RS21185 (4326051) | 4326051..4326362 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QJP67_RS21195 (4326741) | 4326741..4327094 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
QJP67_RS21200 (4327136) | 4327136..4328686 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJP67_RS21205 (4328850) | 4328850..4329320 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QJP67_RS21210 (4329436) | 4329436..4329987 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJP67_RS21215 (4330161) | 4330161..4330379 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJP67_RS21220 (4330405) | 4330405..4330779 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJP67_RS21225 (4331325) | 4331325..4334474 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJP67_RS21230 (4334497) | 4334497..4335690 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279968 WP_001291435.1 NZ_CP124385:c4330379-4330161 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279968 WP_000344800.1 NZ_CP124385:c4330779-4330405 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |