Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3685126..3685961 | Replicon | chromosome |
| Accession | NZ_CP124385 | ||
| Organism | Escherichia coli strain AVS0153 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP67_RS18135 | Protein ID | WP_000854759.1 |
| Coordinates | 3685584..3685961 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP67_RS18130 | Protein ID | WP_001295723.1 |
| Coordinates | 3685126..3685494 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP67_RS18105 (3682241) | 3682241..3682436 | + | 196 | Protein_3542 | DUF905 family protein | - |
| QJP67_RS18110 (3682554) | 3682554..3683372 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP67_RS18115 (3683714) | 3683714..3684187 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP67_RS18120 (3684203) | 3684203..3684679 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJP67_RS18125 (3684742) | 3684742..3684963 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP67_RS18130 (3685126) | 3685126..3685494 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP67_RS18135 (3685584) | 3685584..3685961 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP67_RS18140 (3685958) | 3685958..3686446 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP67_RS18145 (3686463) | 3686463..3686639 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP67_RS18150 (3686745) | 3686745..3686894 | + | 150 | Protein_3551 | hypothetical protein | - |
| QJP67_RS18155 (3687353) | 3687353..3688894 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP67_RS18160 (3688909) | 3688909..3689655 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP67_RS18165 (3689847) | 3689847..3690023 | + | 177 | Protein_3554 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3671431..3700193 | 28762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279964 WP_000854759.1 NZ_CP124385:3685584-3685961 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT279964 WP_001295723.1 NZ_CP124385:3685126-3685494 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |